PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.9NG126900.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family GRAS
Protein Properties Length: 587aa    MW: 63743.6 Da    PI: 5.604
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.9NG126900.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS346.34.9e-1061875563374
                 GRAS   3 elLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetsekn..sseelaalklfsevsPi 90 
                          + Ll+c +  +  d +la   L +++  as dgdp +R+a+yf+ ALa+rla          +ps++s+ +  s+e +  +k++++++P+
  Pavir.9NG126900.1.p 187 QSLLACSRTAA-ADPALAAVELVKVRAAASDDGDPAERVAFYFADALARRLAC-----GGGAQPSTASDARfvSDELTLCYKTLNDACPY 270
                          67999999655.588999999999****************************8.....3333444444444558899999********** PP

                 GRAS  91 lkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegpp.slRiTgvgspesg..skeeleetgerLakfAeelgvpfe 177
                           kf+hltaNqaIlea+ +++++Hi+Df+i qG+QW+aLlqaLa+Rpeg+p ++Ri gv sp  g   + +l +t  rL++fA+ lgv+f+
  Pavir.9NG126900.1.p 271 SKFAHLTANQAILEATGTATKIHIVDFGIVQGIQWAALLQALATRPEGKPsRVRISGVPSPYLGpkPAASLAATSARLRDFAKLLGVDFQ 360
                          **********************************************887769********998888999********************* PP

                 GRAS 178 fnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysal 267
                          f + + + +++l+ ++++v+p+Ea+aVn++lql++ll   ++++++ ++vL+l ksl+P vv++ e e+++n++ F++rf++al yy  +
  Pavir.9NG126900.1.p 361 FVP-LLRPVHELDRSDFSVEPDEAVAVNFMLQLYHLL---GDSDERVRRVLRLAKSLRPSVVTLGEYEISLNRAGFVDRFANALCYYKPV 446
                          ***.599******************************...55555566****************************************** PP

                 GRAS 268 fdsleaklpreseerikvErellgreivnvva.cegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk.sdgyrveees 355
                          f+sl++ ++r+s er+ vEr ++g++i+ +v   eg er+ r+   ++W+  +e +GF+pv+ls++a +qa+ ll +++ +  y++ e  
  Pavir.9NG126900.1.p 447 FESLDVAMARDSPERVRVERCMFGERIRRAVGpEEGVERTDRMAASREWQTLMEWCGFEPVKLSNYARSQADFLLWNYDaKYKYSLVELP 536
                          *******************************8356899*****************************************88889999*99 PP

                 GRAS 356 gslv.lgWkdrpLvsvSaWr 374
                           +++ l W++rpL++vSaWr
  Pavir.9NG126900.1.p 537 PAFLsLAWEKRPLLTVSAWR 556
                          99988**************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098556.247159534IPR005202Transcription factor GRAS
PfamPF035141.7E-103187556IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 587 aa     Download sequence    Send to blast
MAYMCADSGN LMAIAQQVIQ QQQQQQQQQH HHHHLPPPPM QLPPRQAPQM PTAPAPLHGQ  60
IPAAALPYAG GAWAHSEHFF SDTFVGASAA DAVFSDLAAA ADFDSDVWMD SFIGDPPFAD  120
SDLDRLIFTT PPPPIPVPAP AAPPVDVAAQ PEAAAPAPLP QPAAVAAPAA CSSSSSLDAS  180
CSEPVLQSLL ACSRTAAADP ALAAVELVKV RAAASDDGDP AERVAFYFAD ALARRLACGG  240
GAQPSTASDA RFVSDELTLC YKTLNDACPY SKFAHLTANQ AILEATGTAT KIHIVDFGIV  300
QGIQWAALLQ ALATRPEGKP SRVRISGVPS PYLGPKPAAS LAATSARLRD FAKLLGVDFQ  360
FVPLLRPVHE LDRSDFSVEP DEAVAVNFML QLYHLLGDSD ERVRRVLRLA KSLRPSVVTL  420
GEYEISLNRA GFVDRFANAL CYYKPVFESL DVAMARDSPE RVRVERCMFG ERIRRAVGPE  480
EGVERTDRMA ASREWQTLME WCGFEPVKLS NYARSQADFL LWNYDAKYKY SLVELPPAFL  540
SLAWEKRPLL TVSAWRAKIA THLHDFCAFE LANILCFRER DLSARC*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A0.01825561375GRAS family transcription factor containing p
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pvr.221960.0leaf
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ7270180.0KJ727018.1 Zea mays clone pUT3999 GRAS transcription factor (GRAS55) gene, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002466548.10.0hypothetical protein SORBIDRAFT_01g009740
SwissprotQ9FL031e-149SCL4_ARATH; Scarecrow-like protein 4
TrEMBLC5WMW50.0C5WMW5_SORBI; Putative uncharacterized protein Sb01g009740
STRINGSb01g009740.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP85693748
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66770.11e-131GRAS family protein